FAM119A anticorps (N-Term)

N° du produit ABIN632190

Détail du produit anti-FAM119A anticorps

Antigène: FAM119A (Family With Sequence Similarity 119A (FAM119A))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM119A est non-conjugé

Application: Western Blotting (WB)

Specificité: FAM119 A antibody was raised against the N terminal of FAM119

Purification: Affinity purified

Immunogène: FAM119 A antibody was raised using the N terminal of FAM119 corresponding to a region with amino acids ALVPYEETTEFGLQKFHKPLATFSFANHTIQIRQDWRHLGVAAVVWDAAI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM119A Blocking Peptide, catalog no. 33R-1379, is also available for use as a blocking control in assays to test for specificity of this FAM119A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM110 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM119A

Antigène: FAM119A (Family With Sequence Similarity 119A (FAM119A))

Autre désignation: FAM119A (FAM119A Produits)

Synonymes: anticorps 2310038H17Rik, anticorps AI464204, anticorps Fam119a, anticorps FAM119A, anticorps HCA557b, anticorps zgc:110528, anticorps RGD1311824, anticorps methyltransferase like 21A, anticorps Mettl21a, anticorps METTL21A, anticorps mettl21a

Sujet: FAM119A is a multi-pass membrane protein. It belongs to the FAM119 family. The function of the FAM119A protein remains unknown.

Poids moléculaire: 24 kDa (MW of target protein)