DPP3 anticorps (N-Term)

N° du produit ABIN632199

Détail du produit anti-DPP3 anticorps

Antigène: DPP3 (Dipeptidyl-Peptidase 3 (DPP3))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DPP3 est non-conjugé

Application: Western Blotting (WB)

Specificité: DPP3 antibody was raised against the N terminal of DPP3

Purification: Affinity purified

Immunogène: DPP3 antibody was raised using the N terminal of DPP3 corresponding to a region with amino acids SRAAWYGGLAVLLQTSPEAPYIYALLSRLFRAQDPDQLRQHALAEGLTEE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DPP3 Blocking Peptide, catalog no. 33R-8738, is also available for use as a blocking control in assays to test for specificity of this DPP3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPP3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DPP3

Antigène: DPP3 (Dipeptidyl-Peptidase 3 (DPP3))

Autre désignation: DPP3 (DPP3 Produits)

Synonymes: anticorps DPPIII, anticorps dppiii, anticorps MGC68828, anticorps dpp3, anticorps MGC79125, anticorps DKFZp469J1915, anticorps 4930533O14Rik, anticorps C86324, anticorps CG7415, anticorps DPP, anticorps DPP III, anticorps Dmel\\CG7415, anticorps wu:fb64b04, anticorps zgc:86791, anticorps dipeptidyl peptidase 3, anticorps dipeptidylpeptidase 3, anticorps dipeptidyl-peptidase 3 S homeolog, anticorps dipeptidyl-peptidase 3 L homeolog, anticorps dipeptidyl-peptidase 3, anticorps Dipeptidyl aminopeptidase III, anticorps DPP3, anticorps Dpp3, anticorps dpp3.S, anticorps dpp3.L, anticorps CpipJ_CPIJ005356, anticorps PTRG_00518, anticorps MCYG_01338, anticorps MGYG_01882, anticorps dpp3, anticorps DppIII

Sujet: DPP3 is a protein that is a member of the S9B family in clan SC of the serine proteases. This cytoplasmic protein binds a single zinc ion with its zinc-binding motif (HELLGH) and has post-proline dipeptidyl aminopeptidase activity, cleaving Xaa-Pro dipeptides from the N-termini of proteins. Increased activity of this protein is associated with endometrial and ovarian cancers.

Poids moléculaire: 82 kDa (MW of target protein)