serine Dehydratase anticorps (N-Term)

N° du produit ABIN632200

Détail du produit anti-serine Dehydratase anticorps

Antigène: serine Dehydratase (SDS)

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp serine Dehydratase est non-conjugé

Application: Western Blotting (WB)

Specificité: SDS antibody was raised against the N terminal of SDS

Purification: Affinity purified

Immunogène: SDS antibody was raised using the N terminal of SDS corresponding to a region with amino acids AAAYAARQLGVPATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SDS Blocking Peptide, catalog no. 33R-1011, is also available for use as a blocking control in assays to test for specificity of this SDS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SDS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur serine Dehydratase

Antigène: serine Dehydratase (SDS)

Autre désignation: SDS (SDS Produits)

Synonymes: anticorps SDH, anticorps RATSDHE1, anticorps SDH2, anticorps Sdh, anticorps Sdhe1, anticorps TDH, anticorps 4432411H13Rik, anticorps sdh, anticorps serine dehydratase, anticorps serine dehydratase S homeolog, anticorps SDS, anticorps Sds, anticorps sds.S, anticorps sds

Sujet: This gene encodes one of three enzymes that are involved in metabolizing serine and glycine. L-serine dehydratase converts L-serine to pyruvate and ammonia and requires pyridoxal phosphate as a cofactor.

Poids moléculaire: 34 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly