serine Dehydratase anticorps (N-Term)
-
- Antigène Voir toutes serine Dehydratase (SDS) Anticorps
- serine Dehydratase (SDS)
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp serine Dehydratase est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SDS antibody was raised against the N terminal of SDS
- Purification
- Affinity purified
- Immunogène
- SDS antibody was raised using the N terminal of SDS corresponding to a region with amino acids AAAYAARQLGVPATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELA
- Top Product
- Discover our top product SDS Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SDS Blocking Peptide, catalog no. 33R-1011, is also available for use as a blocking control in assays to test for specificity of this SDS antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SDS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- serine Dehydratase (SDS)
- Autre désignation
- SDS (SDS Produits)
- Sujet
- This gene encodes one of three enzymes that are involved in metabolizing serine and glycine. L-serine dehydratase converts L-serine to pyruvate and ammonia and requires pyridoxal phosphate as a cofactor.
- Poids moléculaire
- 34 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly
-