Choline Kinase alpha anticorps (Middle Region)
-
- Antigène Voir toutes Choline Kinase alpha (CHKA) Anticorps
- Choline Kinase alpha (CHKA)
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Choline Kinase alpha est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CHKA antibody was raised against the middle region of CHKA
- Purification
- Affinity purified
- Immunogène
- CHKA antibody was raised using the middle region of CHKA corresponding to a region with amino acids LESVMFAILAERSLGPKLYGIFPQGRLEQFIPSRRLDTEELSLPDISAEI
- Top Product
- Discover our top product CHKA Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CHKA Blocking Peptide, catalog no. 33R-4929, is also available for use as a blocking control in assays to test for specificity of this CHKA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHKA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Choline Kinase alpha (CHKA)
- Autre désignation
- CHKA (CHKA Produits)
- Synonymes
- anticorps im:7143625, anticorps wu:fd46h01, anticorps si:dkey-12e7.3, anticorps CHKA, anticorps chkb, anticorps ATCK1, anticorps CHOLINE KINASE, anticorps CK, anticorps F14O23.8, anticorps F14O23_8, anticorps choline kinase 1, anticorps CHK, anticorps CKI, anticorps EK, anticorps CK/EK-alpha, anticorps Chetk-alpha, anticorps Chk, anticorps ChoK, anticorps EtnK-alpha, anticorps CK-R, anticorps choline kinase alpha, anticorps choline kinase, anticorps choline kinase 1, anticorps chka, anticorps CHKA, anticorps MCYG_00090, anticorps PF14_0020, anticorps CK1, anticorps CNI01400, anticorps Chka
- Sujet
- The major pathway for the biosynthesis of phosphatidylcholine occurs via the CDP-choline pathway. CHKA is the initial enzyme in the sequence and may play a regulatory role. It also catalyzes the phosphorylation of ethanolamine.
- Poids moléculaire
- 50 kDa (MW of target protein)
-