RRAGD anticorps (Middle Region)
-
- Antigène Voir toutes RRAGD Anticorps
- RRAGD (Ras-Related GTP Binding D (RRAGD))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RRAGD est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RRAGD antibody was raised against the middle region of RRAGD
- Purification
- Affinity purified
- Immunogène
- RRAGD antibody was raised using the middle region of RRAGD corresponding to a region with amino acids CDMIDVVIDISCIYGLKEDGAGTPYDKESTAIIKLNNTTVLYLKEVTKFL
- Top Product
- Discover our top product RRAGD Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RRAGD Blocking Peptide, catalog no. 33R-1669, is also available for use as a blocking control in assays to test for specificity of this RRAGD antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RRAGD antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RRAGD (Ras-Related GTP Binding D (RRAGD))
- Autre désignation
- RRAGD (RRAGD Produits)
- Synonymes
- anticorps RAGD, anticorps bA11D8.2.1, anticorps 5730543C08Rik, anticorps AI467523, anticorps C030003H22Rik, anticorps D4Ertd174e, anticorps Ras related GTP binding D, anticorps Ras-related GTP binding D, anticorps RRAGD, anticorps Rragd
- Sujet
- RRAGD is a monomeric guanine nucleotide-binding protein, or G protein. By binding GTP or GDP, small G proteins act as molecular switches in numerous cell processes and signaling pathways.
- Poids moléculaire
- 45 kDa (MW of target protein)
-