VIPAR anticorps (Middle Region)
-
- Antigène Voir toutes VIPAR Anticorps
- VIPAR (VPS33B Interacting Protein, Apical-Basolateral Polarity Regulator (VIPAR))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp VIPAR est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- VIPAR antibody was raised against the middle region of VIPAR
- Purification
- Affinity purified
- Immunogène
- VIPAR antibody was raised using the middle region of VIPAR corresponding to a region with amino acids VEDVDTKLNLATKFKCHDVVIDTYRDLKDRQQLLAYRSKVDKGSAEEEKI
- Top Product
- Discover our top product VIPAR Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
VIPAR Blocking Peptide, catalog no. 33R-9490, is also available for use as a blocking control in assays to test for specificity of this VIPAR antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VIPAR antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- VIPAR (VPS33B Interacting Protein, Apical-Basolateral Polarity Regulator (VIPAR))
- Autre désignation
- VIPAR (VIPAR Produits)
- Synonymes
- anticorps C8H14orf133, anticorps VIPAR, anticorps VPS16, anticorps VPS16A, anticorps spe39, anticorps spe-39, anticorps vps16b, anticorps MGC85203, anticorps c14orf133, anticorps C14orf133, anticorps SPE-39, anticorps SPE39, anticorps VPS16B, anticorps hSPE-39, anticorps 6720456H09Rik, anticorps 9330175H22Rik, anticorps AI413782, anticorps Spe39, anticorps Vipar, anticorps si:ch211-20b12.1, anticorps vipar, anticorps wu:fb63f10, anticorps C10H14orf133, anticorps VPS33B interacting protein, apical-basolateral polarity regulator, spe-39 homolog, anticorps VPS33B interacting protein, apical-basolateral polarity regulator, spe-39 homolog L homeolog, anticorps VIPAS39, anticorps vipas39.L, anticorps vipas39, anticorps Vipas39
- Sujet
- This protein is involved in the sorting of lysosomal proteins. Mutations in this gene are associated with ARCS2 (arthrogryposis, renal dysfunction, and cholestasis-2). Alternative splicing results in multiple transcript variants.
- Poids moléculaire
- 57 kDa (MW of target protein)
-