C11orf65 anticorps (N-Term)
-
- Antigène Tous les produits C11orf65
- C11orf65 (Chromosome 11 Open Reading Frame 65 (C11orf65))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp C11orf65 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- C11 ORF65 antibody was raised against the N terminal Of C11 rf65
- Purification
- Affinity purified
- Immunogène
- C11 ORF65 antibody was raised using the N terminal Of C11 rf65 corresponding to a region with amino acids MPWKEESEFTKQDKAARVIQQAWKSFLNVAIFQHFKSLIDLRRQGEPRQI
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
C11ORF65 Blocking Peptide, catalog no. 33R-6312, is also available for use as a blocking control in assays to test for specificity of this C11ORF65 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF65 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- C11orf65 (Chromosome 11 Open Reading Frame 65 (C11orf65))
- Autre désignation
- C11ORF65 (C11orf65 Produits)
- Synonymes
- anticorps AU017961, anticorps chromosome 11 open reading frame 65, anticorps chromosome 11 open reading frame 65 L homeolog, anticorps chromosome 14 open reading frame, human C11orf65, anticorps RIKEN cDNA 4930550C14 gene, anticorps similar to RIKEN cDNA 4930550C14, anticorps C11orf65, anticorps c11orf65.L, anticorps C14H11orf65, anticorps 4930550C14Rik, anticorps RGD1311251
- Sujet
- The specific function of C11orf65 is not yet known.
- Poids moléculaire
- 37 kDa (MW of target protein)
-