HAGH anticorps (C-Term)

N° du produit ABIN632208

Détail du produit anti-HAGH anticorps

Antigène: HAGH (Hydroxyacylglutathione Hydrolase (HAGH))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HAGH est non-conjugé

Application: Western Blotting (WB)

Specificité: HAGH antibody was raised against the C terminal of HAGH

Purification: Affinity purified

Immunogène: HAGH antibody was raised using the C terminal of HAGH corresponding to a region with amino acids FARHVEPGNAAIREKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HAGH Blocking Peptide, catalog no. 33R-2847, is also available for use as a blocking control in assays to test for specificity of this HAGH antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAGH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HAGH

Antigène: HAGH (Hydroxyacylglutathione Hydrolase (HAGH))

Autre désignation: HAGH (HAGH Produits)

Synonymes: anticorps glo-2, anticorps glo2, anticorps glx2, anticorps glxii, anticorps hagh1, anticorps DDBDRAFT_0186675, anticorps DDBDRAFT_0230988, anticorps DDB_0186675, anticorps DDB_0230988, anticorps DDBDRAFT_0183924, anticorps DDBDRAFT_0230991, anticorps DDB_0183924, anticorps DDB_0230991, anticorps BC019817, anticorps Glo-2, anticorps Glo2, anticorps Rsp29, anticorps RSP29, anticorps fa66a03, anticorps wu:fa66a03, anticorps zgc:73161, anticorps GLO2, anticorps GLX2, anticorps GLXII, anticorps HAGH1, anticorps hydroxyacylglutathione hydrolase L homeolog, anticorps hydroxyacylglutathione hydrolase, anticorps beta-lactamase domain-containing protein, anticorps hydroxyacyl glutathione hydrolase, anticorps hagh.L, anticorps CND02510, anticorps gloB1, anticorps gloB2, anticorps Fbal_1466, anticorps Hagh, anticorps hagh, anticorps HAGH

Sujet: HAGH is classified as a thiolesterase and is responsible for the hydrolysis of S-lactoyl-glutathione to reduced glutathione and D-lactate. The enzyme encoded by this gene is classified as a thiolesterase and is responsible for the hydrolysis of S-lactoyl-glutathione to reduced glutathione and D-lactate.

Poids moléculaire: 29 kDa (MW of target protein)