C12ORF24 anticorps (N-Term)
-
- Antigène Tous les produits C12ORF24 (C12orf24)
- C12ORF24 (C12orf24) (Chromosome 12 Open Reading Frame 24 (C12orf24))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp C12ORF24 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- C12 ORF24 antibody was raised against the N terminal Of C12 rf24
- Purification
- Affinity purified
- Immunogène
- C12 ORF24 antibody was raised using the N terminal Of C12 rf24 corresponding to a region with amino acids AVAGTEGGGGGSAGYSCYQNSKGSDRIKDGYKVNSHIAKLQELWKTPQNQ
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
C12ORF24 Blocking Peptide, catalog no. 33R-1583, is also available for use as a blocking control in assays to test for specificity of this C12ORF24 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF24 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- C12ORF24 (C12orf24) (Chromosome 12 Open Reading Frame 24 (C12orf24))
- Autre désignation
- C12ORF24 (C12orf24 Produits)
- Synonymes
- anticorps C12orf24, anticorps C17H12orf24, anticorps HSU79274, anticorps 1500011H22Rik, anticorps family with sequence similarity 216 member A, anticorps family with sequence similarity 216, member A, anticorps FAM216A, anticorps Fam216a
- Sujet
- The function of C12orf24 protein has not been widely studied, and is yet to be fully elucidated.
- Poids moléculaire
- 31 kDa (MW of target protein)
-