CAMKV anticorps (N-Term)

N° du produit ABIN632211

Détail du produit anti-CAMKV anticorps

Antigène: CAMKV (CaM Kinase-Like Vesicle-Associated (CAMKV))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CAMKV est non-conjugé

Application: Western Blotting (WB)

Specificité: CAMKV antibody was raised against the N terminal of CAMKV

Purification: Affinity purified

Immunogène: CAMKV antibody was raised using the N terminal of CAMKV corresponding to a region with amino acids NRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRFYAISARFKPF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CAMKV Blocking Peptide, catalog no. 33R-6867, is also available for use as a blocking control in assays to test for specificity of this CAMKV antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAMKV antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CAMKV

Antigène: CAMKV (CaM Kinase-Like Vesicle-Associated (CAMKV))

Autre désignation: CAMKV (CAMKV Produits)

Synonymes: anticorps camkv, anticorps zgc:63506, anticorps CAMKV, anticorps 1G5, anticorps VACAMKL, anticorps BB074618, anticorps BC017634, anticorps CaM kinase-like vesicle-associated b, anticorps CaM kinase like vesicle associated, anticorps CaM kinase-like vesicle-associated, anticorps camkvb, anticorps CAMKV, anticorps camkv, anticorps Camkv

Sujet: CAMKV does not appear to have detectable kinase activity.

Poids moléculaire: 55 kDa (MW of target protein)