ADPRM anticorps (N-Term)

N° du produit ABIN632213

Détail du produit anti-ADPRM anticorps

Antigène: ADPRM (C17orf48) (Chromosome 17 Open Reading Frame 48 (C17orf48))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ADPRM est non-conjugé

Application: Western Blotting (WB)

Specificité: C17 ORF48 antibody was raised against the N terminal Of C17 rf48

Purification: Affinity purified

Immunogène: C17 ORF48 antibody was raised using the N terminal Of C17 rf48 corresponding to a region with amino acids MDDKPNPEALSDSSERLFSFGVIADVQFADLEDGFNFQGTRRRYYRHSLL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C17ORF48 Blocking Peptide, catalog no. 33R-5825, is also available for use as a blocking control in assays to test for specificity of this C17ORF48 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF48 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ADPRM

Antigène: ADPRM (C17orf48) (Chromosome 17 Open Reading Frame 48 (C17orf48))

Autre désignation: C17ORF48 (C17orf48 Produits)

Synonymes: anticorps 2310004I24Rik, anticorps MDS006, anticorps C17orf48, anticorps NBLA03831, anticorps C19H17orf48, anticorps ADPRibase-Mn, anticorps RGD1309906, anticorps c17orf48, anticorps mds006, anticorps ADP-ribose/CDP-alcohol diphosphatase, manganese dependent, anticorps ADP-ribose/CDP-alcohol diphosphatase, manganese-dependent, anticorps ADP-ribose/CDP-alcohol diphosphatase, manganese-dependent L homeolog, anticorps Adprm, anticorps ADPRM, anticorps adprm.L

Sujet: C17ORF48 hydrolyzes ADP-ribose, IDP-ribose, CDP-glycerol, CDP-choline and CDP-ethanolamine, but not other non-reducing ADP-sugars or CDP-glucose. May be involved in immune cell signaling as suggested by the second-messenger role of ADP-ribose, which activates TRPM2 as a mediator of oxidative/nitrosative stress.

Poids moléculaire: 39 kDa (MW of target protein)