C17orf57 anticorps (N-Term)

N° du produit ABIN632216

Détail du produit anti-C17orf57 anticorps

Antigène: C17orf57 (Chromosome 17 Open Reading Frame 57 (C17orf57))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C17orf57 est non-conjugé

Application: Western Blotting (WB)

Specificité: C17 ORF57 antibody was raised against the N terminal Of C17 rf57

Purification: Affinity purified

Immunogène: C17 ORF57 antibody was raised using the N terminal Of C17 rf57 corresponding to a region with amino acids CGEEKSSDFSGEKKVGRKSLQVQQHSKRTEIIPPFLKLSKEKVTRKENSL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C17ORF57 Blocking Peptide, catalog no. 33R-1694, is also available for use as a blocking control in assays to test for specificity of this C17ORF57 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF57 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C17orf57

Antigène: C17orf57 (Chromosome 17 Open Reading Frame 57 (C17orf57))

Autre désignation: C17ORF57 (C17orf57 Produits)

Synonymes: anticorps C17orf57, anticorps EF-hand calcium binding domain 13, anticorps EFCAB13

Sujet: The function of C17orf57 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 110 kDa (MW of target protein)