HORMAD2 anticorps (N-Term)
-
- Antigène Voir toutes HORMAD2 Anticorps
- HORMAD2 (HORMA Domain Containing 2 (HORMAD2))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HORMAD2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- HORMAD2 antibody was raised against the N terminal of HORMAD2
- Purification
- Affinity purified
- Immunogène
- HORMAD2 antibody was raised using the N terminal of HORMAD2 corresponding to a region with amino acids VKKLFATSISCITYLRGLFPESSYGERHLDDLSLKILREDKKCPGSLHII
- Top Product
- Discover our top product HORMAD2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
HORMAD2 Blocking Peptide, catalog no. 33R-9626, is also available for use as a blocking control in assays to test for specificity of this HORMAD2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HORMAD2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- HORMAD2 (HORMA Domain Containing 2 (HORMAD2))
- Autre désignation
- HORMAD2 (HORMAD2 Produits)
- Synonymes
- anticorps 4930529M09Rik, anticorps HORMA domain containing 2, anticorps HORMAD2, anticorps Hormad2
- Sujet
- The function of HORMAD protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 35 kDa (MW of target protein)
-