GNaZ anticorps
-
- Antigène Voir toutes GNaZ Anticorps
- GNaZ (Guanine Nucleotide Binding Protein (G Protein), alpha Z Polypeptide (GNaZ))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GNaZ est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- GNAZ antibody was raised using a synthetic peptide corresponding to a region with amino acids LIIYNAIDSLTRIIRALAALRIDFHNPDRAYDAVQLFALTGPAESKGEIT
- Top Product
- Discover our top product GNaZ Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GNAZ Blocking Peptide, catalog no. 33R-5047, is also available for use as a blocking control in assays to test for specificity of this GNAZ antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNAZ antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GNaZ (Guanine Nucleotide Binding Protein (G Protein), alpha Z Polypeptide (GNaZ))
- Autre désignation
- GNAZ (GNaZ Produits)
- Synonymes
- anticorps GXA, anticorps AI847979, anticorps Gz, anticorps G protein subunit alpha z, anticorps guanine nucleotide binding protein, alpha z subunit, anticorps GNAZ, anticorps Gnaz
- Sujet
- GNAZ is a member of a G protein subfamily that mediates signal transduction in pertussis toxin-insensitive systms. This protein may play a role in maintaining the ionic balance of perilymphatic and endolymphatic cochlear fluids.
- Poids moléculaire
- 39 kDa (MW of target protein)
- Pathways
- G-protein mediated Events
-