GFPT2 anticorps (Middle Region)

N° du produit ABIN632223

Détail du produit anti-GFPT2 anticorps

Antigène: GFPT2 (Glutamine-Fructose-6-Phosphate Transaminase 2 (GFPT2))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GFPT2 est non-conjugé

Application: Western Blotting (WB)

Specificité: GFPT2 antibody was raised against the middle region of GFPT2

Purification: Affinity purified

Immunogène: GFPT2 antibody was raised using the middle region of GFPT2 corresponding to a region with amino acids TARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GFPT2 Blocking Peptide, catalog no. 33R-8983, is also available for use as a blocking control in assays to test for specificity of this GFPT2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GFPT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GFPT2

Antigène: GFPT2 (Glutamine-Fructose-6-Phosphate Transaminase 2 (GFPT2))

Autre désignation: GFPT2 (GFPT2 Produits)

Synonymes: anticorps gfpt1, anticorps AI480523, anticorps GFAT2, anticorps glutamine-fructose-6-phosphate transaminase 2 L homeolog, anticorps glutamine-fructose-6-phosphate transaminase 2, anticorps glutamine fructose-6-phosphate transaminase 2, anticorps gfpt2.L, anticorps GFPT2, anticorps gfpt2, anticorps Gfpt2

Sujet: GFPT2 controls the flux of glucose into the hexosamine pathway. GFPT2 is most likely involved in regulating the availability of precursors for N- and O-linked glycosylation of proteins.

Poids moléculaire: 77 kDa (MW of target protein)