GK2 anticorps (C-Term)
-
- Antigène Voir toutes GK2 Anticorps
- GK2 (Glycerol Kinase 2 (GK2))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GK2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GK2 antibody was raised against the C terminal of GK2
- Purification
- Affinity purified
- Immunogène
- GK2 antibody was raised using the C terminal of GK2 corresponding to a region with amino acids QIQATESEIRYATWKKAVMKSMGWVTSQSPEGGDPSIFSSLPLGFFIVSS
- Top Product
- Discover our top product GK2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GK2 Blocking Peptide, catalog no. 33R-7592, is also available for use as a blocking control in assays to test for specificity of this GK2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GK2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GK2 (Glycerol Kinase 2 (GK2))
- Autre désignation
- GK2 (GK2 Produits)
- Synonymes
- anticorps GKP2, anticorps GKTA, anticorps Gk-rs2, anticorps N(alpha)-acetyltransferase 11, NatA catalytic subunit, anticorps glycerol kinase 2, anticorps glycerol kinase, anticorps NAA11, anticorps GK2, anticorps PPA_RS11645, anticorps ATEG_05802, anticorps AGROH133_15068, anticorps Gk2
- Sujet
- GK2 belongs to the FGGY kinase family. GK2 is a key enzyme in the regulation of glycerol uptake and metabolism.
- Poids moléculaire
- 61 kDa (MW of target protein)
-