MAP4K1 anticorps (N-Term)

N° du produit ABIN632239

Détail du produit anti-MAP4K1 anticorps

Antigène: MAP4K1 (Mitogen-Activated Protein Kinase Kinase Kinase Kinase 1 (MAP4K1))

Épitope: N-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAP4K1 est non-conjugé

Application: Western Blotting (WB)

Specificité: MAP4 K1 antibody was raised against the N terminal of MAP4 1

Purification: Affinity purified

Immunogène: MAP4 K1 antibody was raised using the N terminal of MAP4 1 corresponding to a region with amino acids VHPLRVLFLMTKSGYQPPRLKEKGKWSAAFHNFIKVTLTKSPKKRPSATK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MAP4K1 Blocking Peptide, catalog no. 33R-9582, is also available for use as a blocking control in assays to test for specificity of this MAP4K1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MAP4K1

Antigène: MAP4K1 (Mitogen-Activated Protein Kinase Kinase Kinase Kinase 1 (MAP4K1))

Autre désignation: MAP4K1 (MAP4K1 Produits)

Synonymes: anticorps HPK1, anticorps Hpk1, anticorps mHPK1, anticorps mitogen activated protein kinase kinase kinase kinase 1, anticorps mitogen-activated protein kinase kinase kinase kinase 1, anticorps Map4k1, anticorps MAP4K1

Sujet: MAP4K1 belongs to the protein kinase superfamily, STE Ser/Thr protein kinase family, STE20 subfamily. MAP4K1 may play a role in the response to environmental stress. It appears to act upstream of the JUN N-terminal pathway. MAP4K1 may play a role in hematopoietic lineage decisions and growth regulation.

Poids moléculaire: 90 kDa (MW of target protein)

Pathways: TCR Signaling, Signaling of Hepatocyte Growth Factor Receptor