KLHDC8B anticorps (N-Term)
-
- Antigène Voir toutes KLHDC8B Anticorps
- KLHDC8B (Kelch Domain Containing 8B (KLHDC8B))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KLHDC8B est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- KLHDC8 B antibody was raised against the N terminal of KLHDC8
- Purification
- Affinity purified
- Immunogène
- KLHDC8 B antibody was raised using the N terminal of KLHDC8 corresponding to a region with amino acids MSAGGGRAFAWQVFPPMPTCRVYGTVAHQDGHLLVLGGCGRAGLPLDTAE
- Top Product
- Discover our top product KLHDC8B Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KLHDC8B Blocking Peptide, catalog no. 33R-6393, is also available for use as a blocking control in assays to test for specificity of this KLHDC8B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHDC0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KLHDC8B (Kelch Domain Containing 8B (KLHDC8B))
- Autre désignation
- KLHDC8B (KLHDC8B Produits)
- Synonymes
- anticorps DKFZp468J2023, anticorps 4931406O17Rik, anticorps kelch domain containing 8B, anticorps KLHDC8B, anticorps Klhdc8b
- Sujet
- KLHDC8B contains 8 Kelch repeats. The exact function of KLHDC8B remains unknown.
- Poids moléculaire
- 38 kDa (MW of target protein)
-