TBCB anticorps (C-Term)

N° du produit ABIN632246

Détail du produit anti-TBCB anticorps

Antigène: TBCB (Tubulin Folding Cofactor B (TBCB))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TBCB est non-conjugé

Application: Western Blotting (WB)

Specificité: TBCB antibody was raised against the C terminal of TBCB

Purification: Affinity purified

Immunogène: TBCB antibody was raised using the C terminal of TBCB corresponding to a region with amino acids YDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TBCB Blocking Peptide, catalog no. 33R-10065, is also available for use as a blocking control in assays to test for specificity of this TBCB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBCB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TBCB

Antigène: TBCB (Tubulin Folding Cofactor B (TBCB))

Autre désignation: TBCB (TBCB Produits)

Synonymes: anticorps CG22, anticorps CKAP1, anticorps CKAPI, anticorps 2410007D12Rik, anticorps AU041393, anticorps Ckap1, anticorps ZH14, anticorps ckap1, anticorps ik:tdsubc_2e4, anticorps wu:fa56d03, anticorps xx:tdsubc_2e4, anticorps zgc:55620, anticorps TBCB, anticorps cg22, anticorps ckapi, anticorps CG11242, anticorps Dmel\CG11242, anticorps dTBCB, anticorps tubulin folding cofactor B, anticorps tubulin folding cofactor B S homeolog, anticorps tubulin-folding cofactor B, anticorps tubulin-binding cofactor B, anticorps TBCB, anticorps Tbcb, anticorps tbcb, anticorps tbcb.S, anticorps EMB2804, anticorps LOC9320850

Sujet: TBCB binds to alpha-tubulin folding intermediates after their interaction with cytosolic chaperonin in the pathway leading from newly synthesized tubulin to properly folded heterodimer. It is involved in regulation of tubulin heterodimer dissociation. TBCB may function as a negative regulator of axonal growth.

Poids moléculaire: 27 kDa (MW of target protein)