C1ORF110 anticorps (N-Term)

N° du produit ABIN632261

Détail du produit anti-C1ORF110 anticorps

Antigène: C1ORF110 (Chromosome 1 Open Reading Frame 110 (C1ORF110))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C1ORF110 est non-conjugé

Application: Western Blotting (WB)

Specificité: C1 ORF110 antibody was raised against the N terminal Of C1 rf110

Purification: Affinity purified

Immunogène: C1 ORF110 antibody was raised using the N terminal Of C1 rf110 corresponding to a region with amino acids LKVICLYHVKLLTWEQRQLQKELQRLQQAETMKKKFSSYLGNGFQKRPED

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C1ORF110 Blocking Peptide, catalog no. 33R-5112, is also available for use as a blocking control in assays to test for specificity of this C1ORF110 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF110 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C1ORF110

Antigène: C1ORF110 (Chromosome 1 Open Reading Frame 110 (C1ORF110))

Autre désignation: C1ORF110 (C1ORF110 Produits)

Synonymes: anticorps C1orf110, anticorps coiled-coil domain containing 190, anticorps CCDC190, anticorps Ccdc190

Sujet: The function of C1orf110 has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 34 kDa (MW of target protein)