PEX7 anticorps (N-Term)
-
- Antigène Voir toutes PEX7 Anticorps
- PEX7 (Peroxisomal Biogenesis Factor 7 (PEX7))
-
Épitope
- N-Term
-
Reactivité
- Souris, Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PEX7 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PEX7 antibody was raised against the N terminal of PEX7
- Purification
- Affinity purified
- Immunogène
- PEX7 antibody was raised using the N terminal of PEX7 corresponding to a region with amino acids MSAVCGGAARMLRTPGRHGYAAEFSPYLPGRLACATAQHYGIAGCGTLLI
- Top Product
- Discover our top product PEX7 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PEX7 Blocking Peptide, catalog no. 33R-6402, is also available for use as a blocking control in assays to test for specificity of this PEX7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEX7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PEX7 (Peroxisomal Biogenesis Factor 7 (PEX7))
- Autre désignation
- PEX7 (PEX7 Produits)
- Synonymes
- anticorps PEX7, anticorps pex7, anticorps DDBDRAFT_0206295, anticorps DDBDRAFT_0233068, anticorps DDB_0206295, anticorps DDB_0233068, anticorps MmPEX7, anticorps PBD9B, anticorps PTS2R, anticorps RCDP1, anticorps RD, anticorps zgc:103552, anticorps Peroxin-7, anticorps peroxisomal biogenesis factor 7, anticorps WD40 repeat-containing protein, anticorps PEX7, anticorps pex7, anticorps Pex7
- Sujet
- PEX7 binds to the N-terminal PTS2-type peroxisomal targeting signal and plays an essential role in peroxisomal protein import.
- Poids moléculaire
- 36 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-