PRKY anticorps (N-Term)
-
- Antigène Tous les produits PRKY
- PRKY (Serine/threonine-Protein Kinase PRKY (PRKY))
-
Épitope
- N-Term
- Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PRKY est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PRKY antibody was raised against the N terminal of PRKY
- Purification
- Affinity purified
- Immunogène
- PRKY antibody was raised using the N terminal of PRKY corresponding to a region with amino acids MEAPGPAQAAAAESNSREVTEDAADWAPALCPSPEARSPEAPAYRLQDCD
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PRKY Blocking Peptide, catalog no. 33R-5895, is also available for use as a blocking control in assays to test for specificity of this PRKY antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKY antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PRKY (Serine/threonine-Protein Kinase PRKY (PRKY))
- Autre désignation
- PRKY (PRKY Produits)
- Synonymes
- anticorps PRKXP3, anticorps PRKYP, anticorps protein kinase, Y-linked, pseudogene, anticorps PRKY
- Sujet
- This gene is similar to the protein kinase, X-linked gene in the pseudoautosomal region of the X chromsoome.
- Poids moléculaire
- 32 kDa (MW of target protein)
-