CAB39 anticorps (Middle Region)

N° du produit ABIN632269

Détail du produit anti-CAB39 anticorps

Antigène: CAB39 (Calcium Binding Protein 39 (CAB39))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CAB39 est non-conjugé

Application: Western Blotting (WB)

Specificité: CAB39 antibody was raised against the middle region of CAB39

Purification: Affinity purified

Immunogène: CAB39 antibody was raised using the middle region of CAB39 corresponding to a region with amino acids KTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CAB39 Blocking Peptide, catalog no. 33R-4688, is also available for use as a blocking control in assays to test for specificity of this CAB39 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAB39 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CAB39

Antigène: CAB39 (Calcium Binding Protein 39 (CAB39))

Autre désignation: CAB39 (CAB39 Produits)

Synonymes: anticorps CG4083, anticorps Dmel\\CG4083, anticorps Dmo25, anticorps dMo25, anticorps l(3)00274, anticorps mo25, anticorps fc06a03, anticorps zgc:86716, anticorps wu:fc06a03, anticorps MGC78903, anticorps CAB39, anticorps MO25, anticorps AA408805, anticorps AA960512, anticorps C78372, anticorps MO25alpha, anticorps CG4083 gene product from transcript CG4083-RA, anticorps calcium binding protein 39, anticorps calcium binding protein 39 L homeolog, anticorps Cab39 protein, anticorps Mo25, anticorps cab39, anticorps cab39.L, anticorps CAB39, anticorps Bm1_33380, anticorps Cab39

Sujet: Together with the STE20-related adaptor-alpha (STRAD alpha) pseudo kinase, CAB39 forms a regulatory complex capable of stimulating the activity of STK11.

Poids moléculaire: 40 kDa (MW of target protein)

Pathways: AMPK Signaling