RGS5 anticorps (Middle Region)
-
- Antigène Voir toutes RGS5 Anticorps
- RGS5 (Regulator of G-Protein Signaling 5 (RGS5))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RGS5 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RGS5 antibody was raised against the middle region of RGS5
- Purification
- Affinity purified
- Immunogène
- RGS5 antibody was raised using the middle region of RGS5 corresponding to a region with amino acids PGLAKPQHVTETFHPDPNWKNFQKPGTWRGSLDESSLGFGYPKFISHQDI
- Top Product
- Discover our top product RGS5 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RGS5 Blocking Peptide, catalog no. 33R-7114, is also available for use as a blocking control in assays to test for specificity of this RGS5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RGS5 (Regulator of G-Protein Signaling 5 (RGS5))
- Autre désignation
- RGS5 (RGS5 Produits)
- Synonymes
- anticorps MST092, anticorps MST106, anticorps MST129, anticorps MSTP032, anticorps MSTP092, anticorps MSTP106, anticorps MSTP129, anticorps RGS5, anticorps 1110070A02Rik, anticorps fj30h05, anticorps rgs5, anticorps wu:fj30h05, anticorps zgc:64006, anticorps xrgs5, anticorps MGC147439, anticorps zgc:110206, anticorps regulator of G protein signaling 5, anticorps regulator of G-protein signaling 5, anticorps regulator of G protein signaling 5a, anticorps regulator of G-protein signaling 5 L homeolog, anticorps regulator of G protein signaling 5b, anticorps RGS5, anticorps Rgs5, anticorps rgs5a, anticorps rgs5, anticorps rgs5.L, anticorps rgs5b
- Sujet
- The regulator of G protein signaling (RGS) proteins are signal transduction molecules that have structural homology to SST2 of Saccharomyces cerevisiae and EGL-10 of Caenorhabditis elegans. Multiple genes homologous to SST2 are present in higher eukaryotes. RGS proteins are involved in the regulation of heterotrimeric G proteins by acting as GTPase activators.
- Poids moléculaire
- 21 kDa (MW of target protein)
- Pathways
- Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling
-