PRMT3 anticorps (Middle Region)
-
- Antigène Voir toutes PRMT3 Anticorps
- PRMT3 (Protein Arginine Methyltransferase 3 (PRMT3))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PRMT3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PRMT3 antibody was raised against the middle region of PRMT3
- Purification
- Affinity purified
- Immunogène
- PRMT3 antibody was raised using the middle region of PRMT3 corresponding to a region with amino acids LEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWK
- Top Product
- Discover our top product PRMT3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PRMT3 Blocking Peptide, catalog no. 33R-4896, is also available for use as a blocking control in assays to test for specificity of this PRMT3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRMT3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PRMT3 (Protein Arginine Methyltransferase 3 (PRMT3))
- Autre désignation
- PRMT3 (PRMT3 Produits)
- Synonymes
- anticorps HRMT1L3, anticorps 2010005E20Rik, anticorps 2410018A17Rik, anticorps AL033309, anticorps Hrmt1l3, anticorps PRMT3, anticorps hrmt1l3, anticorps zgc:112498, anticorps ARABIDOPSIS THALIANA PROTEIN ARGININE METHYLTRANSFERASE 3, anticorps ATPRMT3, anticorps protein arginine methyltransferase 3, anticorps protein arginine methyltransferase 3, anticorps protein arginine N-methyltransferase 3, anticorps protein arginine methyltransferase 3 S homeolog, anticorps PRMT3, anticorps Prmt3, anticorps prmt3, anticorps prmt3.S
- Sujet
- Type I protein arginine N-methyltransferases (PRMTs), such as PRMT3, catalyze the formation of asymmetric N(G),N(G)-dimethylarginine (ADMA) residues in proteins.
- Poids moléculaire
- 60 kDa (MW of target protein)
- Pathways
- Protein targeting to Nucleus
-