PRMT6 anticorps (Middle Region)
-
- Antigène Voir toutes PRMT6 Anticorps
- PRMT6 (Protein Arginine Methyltransferase 6 (PRMT6))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PRMT6 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PRMT6 antibody was raised against the middle region of PRMT6
- Purification
- Affinity purified
- Immunogène
- PRMT6 antibody was raised using the middle region of PRMT6 corresponding to a region with amino acids FRCSCYGSAPMHGFAIWFQVTFPGGESEKPLVLSTSPFHPATHWKQALLY
- Top Product
- Discover our top product PRMT6 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PRMT6 Blocking Peptide, catalog no. 33R-3040, is also available for use as a blocking control in assays to test for specificity of this PRMT6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRMT6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PRMT6 (Protein Arginine Methyltransferase 6 (PRMT6))
- Autre désignation
- PRMT6 (PRMT6 Produits)
- Synonymes
- anticorps CG9927, anticorps DART6, anticorps Dmel\\CG9927, anticorps PRMT6, anticorps HRMT1L6, anticorps ARABIDOPSIS THALIANA PROTEIN ARGININE METHYLTRANSFERASE 6, anticorps ATPRMT6, anticorps protein arginine methyltransferase 6, anticorps DKFZp459B1431, anticorps Hrmt1l6, anticorps hrmt1l6, anticorps hrmt6, anticorps im:6908706, anticorps AW124876, anticorps BB233495, anticorps Arginine methyltransferase 6, anticorps protein arginine methyltransferase 6, anticorps protein arginine methyltransferase 6 S homeolog, anticorps arginine N-methyltransferase, type I, anticorps protein arginine N-methyltransferase 6, anticorps Art6, anticorps PRMT6, anticorps prmt6.S, anticorps prmt6, anticorps Prmt6
- Sujet
- Protein arginine N-methyltransferases, such as PRMT6, catalyze the sequential transfer of a methyl group from S-adenosyl-L-methionine to the side chain nitrogens of arginine residues within proteins to form methylated arginine derivatives and S-adenosyl-L-homocysteine.
- Poids moléculaire
- 35 kDa (MW of target protein)
-