PPME1 anticorps (N-Term)

N° du produit ABIN632281

Détail du produit anti-PPME1 anticorps

Antigène: PPME1 (Protein Phosphatase Methylesterase 1 (PPME1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PPME1 est non-conjugé

Application: Western Blotting (WB)

Specificité: PPME1 antibody was raised against the N terminal of PPME1

Purification: Affinity purified

Immunogène: PPME1 antibody was raised using the N terminal of PPME1 corresponding to a region with amino acids MSALEKSMHLGRLPSRPPLPGSGGSQSGAKMRMGPGRKRDFSPVPWSQYF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PPME1 Blocking Peptide, catalog no. 33R-6394, is also available for use as a blocking control in assays to test for specificity of this PPME1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPME1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PPME1

Antigène: PPME1 (Protein Phosphatase Methylesterase 1 (PPME1))

Autre désignation: PPME1 (PPME1 Produits)

Synonymes: anticorps PME-1, anticorps 1110069N17Rik, anticorps 2700017M01Rik, anticorps Pme1, anticorps fk72d03, anticorps zgc:56239, anticorps wu:fk72d03, anticorps RGD1309683, anticorps PME1MGC133824, anticorps F28M11.4, anticorps DDBDRAFT_0204584, anticorps DDBDRAFT_0305014, anticorps DDB_0204584, anticorps DDB_0305014, anticorps PME1, anticorps CaO19.1459, anticorps protein phosphatase methylesterase 1, anticorps protein phosphatase methylesterase 1 S homeolog, anticorps esterase/lipase/thioesterase family protein, anticorps carboxylesterase-mitochondrial 37S ribosomal protein YmS2, anticorps PPME1, anticorps Ppme1, anticorps ppme1, anticorps ppme1.S, anticorps AT4G10050, anticorps PPE1

Sujet: Protein phosphatase methylesterase-1 catalyzes the demethylation of the protein phosphatase-2A catalytic subunit.

Poids moléculaire: 42 kDa (MW of target protein)

Pathways: Methionine Biosynthetic Process