C1orf92 anticorps (Middle Region)
-
- Antigène Tous les produits C1orf92 (LRRC71)
- C1orf92 (LRRC71) (Leucine Rich Repeat Containing 71 (LRRC71))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp C1orf92 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- C1 ORF92 antibody was raised against the middle region of C1 rf92
- Purification
- Affinity purified
- Immunogène
- C1 ORF92 antibody was raised using the middle region of C1 rf92 corresponding to a region with amino acids VDKTDKTQTMKTPKGLGKKKEKSWELAKKEEKLGSGQSPTQGTPKKEDAT
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
C1ORF92 Blocking Peptide, catalog no. 33R-9468, is also available for use as a blocking control in assays to test for specificity of this C1ORF92 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF92 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- C1orf92 (LRRC71) (Leucine Rich Repeat Containing 71 (LRRC71))
- Autre désignation
- C1ORF92 (LRRC71 Produits)
- Synonymes
- anticorps C1orf92, anticorps RP11-356J7.1, anticorps 4933430H15Rik, anticorps cilia and flagella associated protein 46, anticorps leucine rich repeat containing 71, anticorps cfap46, anticorps LRRC71, anticorps Lrrc71
- Sujet
- The function of Chromosome 1 ORF protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 39 kDa (MW of target protein)
-