GRIPAP1 anticorps (N-Term)
-
- Antigène Voir toutes GRIPAP1 Anticorps
- GRIPAP1 (GRIP1 Associated Protein 1 (GRIPAP1))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GRIPAP1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GRIPAP1 antibody was raised against the N terminal of GRIPAP1
- Purification
- Affinity purified
- Immunogène
- GRIPAP1 antibody was raised using the N terminal of GRIPAP1 corresponding to a region with amino acids ENTALQKNVAALQERYGKEAGKFSAVSEGQGDPPGGPAPTVLAPMPLAEV
- Top Product
- Discover our top product GRIPAP1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GRIPAP1 Blocking Peptide, catalog no. 33R-2618, is also available for use as a blocking control in assays to test for specificity of this GRIPAP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRIPAP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GRIPAP1 (GRIP1 Associated Protein 1 (GRIPAP1))
- Autre désignation
- GRIPAP1 (GRIPAP1 Produits)
- Synonymes
- anticorps gripap1, anticorps MGC184827, anticorps zgc:158787, anticorps GRASP-1, anticorps AI854681, anticorps DXImx47e, anticorps Sfc10, anticorps mKIAA1167, anticorps Grasp1, anticorps GRIP1 associated protein 1, anticorps gripap1, anticorps GRIPAP1, anticorps Gripap1
- Sujet
- This gene encodes a guanine nucleotide exchange factor for the Ras family of small G proteins (RasGEF). In brain studies, the encoded protein was found with the GRIP/AMPA receptor complex. Multiple alternatively spliced transcript variants have been described that encode different protein isoforms, however, the full-length nature and biological validity of all of these variants have not been determined.
- Poids moléculaire
- 96 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-