SEC14L4 anticorps

N° du produit ABIN632289

Détail du produit anti-SEC14L4 anticorps

Antigène: SEC14L4 (SEC14-Like 4 (SEC14L4))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SEC14L4 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SEC14 L4 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSSRVGDLSPQQQEALARFRENLQDLLPILPNADDYFLLRWLRARNFDLQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SEC14L4 Blocking Peptide, catalog no. 33R-6510, is also available for use as a blocking control in assays to test for specificity of this SEC14L4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEC10 4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SEC14L4

Antigène: SEC14L4 (SEC14-Like 4 (SEC14L4))

Autre désignation: SEC14L4 (SEC14L4 Produits)

Synonymes: anticorps TAP3, anticorps AI256582, anticorps AW536553, anticorps SPF, anticorps TAP, anticorps RGD1565810, anticorps SEC14 like lipid binding 4, anticorps SEC14-like protein 4, anticorps SEC14-like lipid binding 4, anticorps SEC14L4, anticorps LOC486353, anticorps Sec14l4

Sujet: SEC14L4 is a probable hydrophobic ligand-binding protein, may play a role in the transport of hydrophobic ligands like tocopherol, squalene and phospholipids.

Poids moléculaire: 47 kDa (MW of target protein)