ARL11 anticorps (Middle Region)

N° du produit ABIN632291

Détail du produit anti-ARL11 anticorps

Antigène: ARL11 (ADP-Ribosylation Factor-Like 11 (ARL11))

Épitope: Middle Region

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ARL11 est non-conjugé

Application: Western Blotting (WB)

Specificité: ARL11 antibody was raised against the middle region of ARL11

Purification: Affinity purified

Immunogène: ARL11 antibody was raised using the middle region of ARL11 corresponding to a region with amino acids WKDYLEGTDILVYVLDSTDEARLPESAAELTEVLNDPNMAGVPFLVLANK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ARL11 Blocking Peptide, catalog no. 33R-9959, is also available for use as a blocking control in assays to test for specificity of this ARL11 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARL11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ARL11

Antigène: ARL11 (ADP-Ribosylation Factor-Like 11 (ARL11))

Autre désignation: ARL11 (ARL11 Produits)

Synonymes: anticorps zgc:56090, anticorps wu:fc38d01, anticorps arl11, anticorps MGC89886, anticorps ARL11, anticorps MGC154392, anticorps ARLTS1, anticorps C730007L20Rik, anticorps ADP-ribosylation factor-like 11, anticorps ADP ribosylation factor like GTPase 11, anticorps ADP-ribosylation factor like GTPase 11, anticorps arl11, anticorps ARL11, anticorps Arl11

Sujet: ARL11 belongs to the small GTPase superfamily, Arf family. It may play a role in apoptosis and act as a tumor suppressor. Defects in ARL11 may be a cause of susceptibility to chronic lymphocytic leukemia (CLL).

Poids moléculaire: 21 kDa (MW of target protein)