TRABD anticorps (Middle Region)

N° du produit ABIN632292

Détail du produit anti-TRABD anticorps

Antigène: TRABD (TraB Domain Containing (TRABD))

Épitope: Middle Region

Reactivité: Souris, Rat, Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRABD est non-conjugé

Application: Western Blotting (WB)

Specificité: TRABD antibody was raised against the middle region of TRABD

Purification: Affinity purified

Immunogène: TRABD antibody was raised using the middle region of TRABD corresponding to a region with amino acids LCFLSDPISKDDVERCKQKDLLEQMMAEMIGEFPDLHRTIVSERDVYLTY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRABD Blocking Peptide, catalog no. 33R-4818, is also available for use as a blocking control in assays to test for specificity of this TRABD antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRABD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRABD

Antigène: TRABD (TraB Domain Containing (TRABD))

Autre désignation: TRABD (TRABD Produits)

Synonymes: anticorps TRABD, anticorps LP6054, anticorps PP2447, anticorps fb66c10, anticorps wu:fb66c10, anticorps wu:fi04e11, anticorps zgc:66436, anticorps 5730502D15Rik, anticorps AL023039, anticorps RGD1310875, anticorps TraB domain containing, anticorps TraB domain containing L homeolog, anticorps TRABD, anticorps trabd, anticorps trabd.L, anticorps Trabd

Sujet: The function of TRABD protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 42 kDa (MW of target protein)