TRABD anticorps (Middle Region)
-
- Antigène Tous les produits TRABD
- TRABD (TraB Domain Containing (TRABD))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TRABD est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TRABD antibody was raised against the middle region of TRABD
- Purification
- Affinity purified
- Immunogène
- TRABD antibody was raised using the middle region of TRABD corresponding to a region with amino acids LCFLSDPISKDDVERCKQKDLLEQMMAEMIGEFPDLHRTIVSERDVYLTY
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TRABD Blocking Peptide, catalog no. 33R-4818, is also available for use as a blocking control in assays to test for specificity of this TRABD antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRABD antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TRABD (TraB Domain Containing (TRABD))
- Autre désignation
- TRABD (TRABD Produits)
- Synonymes
- anticorps TRABD, anticorps LP6054, anticorps PP2447, anticorps fb66c10, anticorps wu:fb66c10, anticorps wu:fi04e11, anticorps zgc:66436, anticorps 5730502D15Rik, anticorps AL023039, anticorps RGD1310875, anticorps TraB domain containing, anticorps TraB domain containing L homeolog, anticorps TRABD, anticorps trabd, anticorps trabd.L, anticorps Trabd
- Sujet
- The function of TRABD protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 42 kDa (MW of target protein)
-