Proline Rich 13 anticorps (N-Term)

N° du produit ABIN632293

Détail du produit anti-Proline Rich 13 anticorps

Antigène: Proline Rich 13 (PRR13)

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Proline Rich 13 est non-conjugé

Application: Western Blotting (WB)

Specificité: PRR13 antibody was raised against the N terminal of PRR13

Purification: Affinity purified

Immunogène: PRR13 antibody was raised using the N terminal of PRR13 corresponding to a region with amino acids MWNPNAGQPGPNPYPPNIGCPGGSNPAHPPPINPPFPPGPCPPPPGAPHG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRR13 Blocking Peptide, catalog no. 33R-6618, is also available for use as a blocking control in assays to test for specificity of this PRR13 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRR13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Proline Rich 13

Antigène: Proline Rich 13 (PRR13)

Autre désignation: PRR13 (PRR13 Produits)

Synonymes: anticorps MGC133876, anticorps TXR1, anticorps 1110020C13Rik, anticorps 2010324E22Rik, anticorps RGD1307129, anticorps proline rich 13, anticorps PRR13, anticorps Prr13

Sujet: PRR13 negatively regulates TSP1 expression at the level of transcription. This down-regulation was shown to reduce taxane-induced apoptosis.

Poids moléculaire: 15 kDa (MW of target protein)