CRYM anticorps (N-Term)

N° du produit ABIN632295

Détail du produit anti-CRYM anticorps

Antigène: CRYM (Crystallin, mu (CRYM))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CRYM est non-conjugé

Application: Western Blotting (WB)

Specificité: Crystallin Mu antibody was raised against the N terminal of CRYM

Purification: Affinity purified

Immunogène: Crystallin Mu antibody was raised using the N terminal of CRYM corresponding to a region with amino acids ALTTKLVTFYEDRGITSVVPSHQATVLLFEPSNGTLLAVMDGNVITAKRT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Crystallin Mu Blocking Peptide, catalog no. 33R-1375, is also available for use as a blocking control in assays to test for specificity of this Crystallin Mu antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRYM antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CRYM

Antigène: CRYM (Crystallin, mu (CRYM))

Autre désignation: Crystallin mu (CRYM Produits)

Synonymes: anticorps CRYM, anticorps zgc:158843, anticorps DFNA40, anticorps THBP, anticorps crystallin mu, anticorps crystallin, mu, anticorps Cro/Cl family transcriptional regulator, anticorps crystallin mu L homeolog, anticorps CRYM, anticorps crym, anticorps EAMY_RS27495, anticorps crym.L, anticorps Crym

Sujet: Crystallins are separated into two classes: taxon-specific and ubiquitous. The former class is also called phylogenetically-restricted crystallins. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens.

Poids moléculaire: 34 kDa (MW of target protein)

Pathways: Hormone Transport, Sensory Perception of Sound