LDHB anticorps (C-Term)

N° du produit ABIN632307

Détail du produit anti-LDHB anticorps

Antigène: LDHB (Lactate Dehydrogenase B (LDHB))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LDHB est non-conjugé

Application: Western Blotting (WB)

Specificité: LDHB antibody was raised against the C terminal of LDHB

Purification: Affinity purified

Immunogène: LDHB antibody was raised using the C terminal of LDHB corresponding to a region with amino acids MYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LDHB Blocking Peptide, catalog no. 33R-6625, is also available for use as a blocking control in assays to test for specificity of this LDHB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LDHB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LDHB

Antigène: LDHB (Lactate Dehydrogenase B (LDHB))

Autre désignation: LDHB (LDHB Produits)

Sujet: LDHB belongs to the LDH/MDH superfamily, LDH family. Defects in LDHB are a cause of hereditary LDHB deficiency. LDHB may also have roles in progression of medulloblastoma.

Poids moléculaire: 37 kDa (MW of target protein)

Pathways: L'effet Warburg