LCA5 anticorps (N-Term)
-
- Antigène Voir toutes LCA5 Anticorps
- LCA5 (Leber Congenital Amaurosis 5 (LCA5))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LCA5 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- LCA5 antibody was raised against the N terminal of LCA5
- Purification
- Affinity purified
- Immunogène
- LCA5 antibody was raised using the N terminal of LCA5 corresponding to a region with amino acids FSLQKLKEISEARHLPERDDLAKKLVSAELKLDDTERRIKELSKNLELST
- Top Product
- Discover our top product LCA5 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LCA5 Blocking Peptide, catalog no. 33R-3071, is also available for use as a blocking control in assays to test for specificity of this LCA5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LCA5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LCA5 (Leber Congenital Amaurosis 5 (LCA5))
- Autre désignation
- LCA5 (LCA5 Produits)
- Sujet
- LCA5 is a protein that is thought to be involved in centrosomal or ciliary functions. Mutations in this gene cause Leber congenital amaurosis type V. Mutations in this gene cause Leber congenital amaurosis type V. Alternative splicing results in two transcript variants.
- Poids moléculaire
- 80 kDa (MW of target protein)
-