LCA5 anticorps (N-Term)

N° du produit ABIN632308

Détail du produit anti-LCA5 anticorps

Antigène: LCA5 (Leber Congenital Amaurosis 5 (LCA5))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LCA5 est non-conjugé

Application: Western Blotting (WB)

Specificité: LCA5 antibody was raised against the N terminal of LCA5

Purification: Affinity purified

Immunogène: LCA5 antibody was raised using the N terminal of LCA5 corresponding to a region with amino acids FSLQKLKEISEARHLPERDDLAKKLVSAELKLDDTERRIKELSKNLELST

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LCA5 Blocking Peptide, catalog no. 33R-3071, is also available for use as a blocking control in assays to test for specificity of this LCA5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LCA5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LCA5

Antigène: LCA5 (Leber Congenital Amaurosis 5 (LCA5))

Autre désignation: LCA5 (LCA5 Produits)

Synonymes: anticorps C6orf152, anticorps RGD1308555, anticorps 4930431B11Rik, anticorps 5730406O13Rik, anticorps AV274874, anticorps ORF64, anticorps LCA5, lebercilin, anticorps Leber congenital amaurosis 5, anticorps Leber congenital amaurosis 5 (human), anticorps LCA5, anticorps LOC787523, anticorps Lca5

Sujet: LCA5 is a protein that is thought to be involved in centrosomal or ciliary functions. Mutations in this gene cause Leber congenital amaurosis type V. Mutations in this gene cause Leber congenital amaurosis type V. Alternative splicing results in two transcript variants.

Poids moléculaire: 80 kDa (MW of target protein)