Cyclin J anticorps (N-Term)

N° du produit ABIN632310

Détail du produit anti-Cyclin J anticorps

Antigène: Cyclin J (CCNJ)

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Cyclin J est non-conjugé

Application: Western Blotting (WB)

Specificité: Cyclin J antibody was raised against the N terminal of CCNJ

Purification: Affinity purified

Immunogène: Cyclin J antibody was raised using the N terminal of CCNJ corresponding to a region with amino acids FMDRYDISIQQLHLVALSCLLLASKFEEKEDSVPKLEQLNSLGCMTNMNL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Cyclin J Blocking Peptide, catalog no. 33R-2996, is also available for use as a blocking control in assays to test for specificity of this Cyclin J antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCNJ antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Cyclin J

Antigène: Cyclin J (CCNJ)

Autre désignation: Cyclin J (CCNJ Produits)

Synonymes: anticorps bA690P14.1, anticorps CDI5, anticorps CG10308, anticorps Cdi5, anticorps Dmel\\CG10308, anticorps cdi5, anticorps cycJ, anticorps cyclinJ, anticorps D430039C20Rik, anticorps MGC81420, anticorps ba690p14.1, anticorps cyclin J, anticorps Cyclin J, anticorps cyclin J S homeolog, anticorps CCNJ, anticorps CycJ, anticorps Ccnj, anticorps ccnj.S, anticorps ccnj, anticorps CpipJ_CPIJ015384, anticorps CpipJ_CPIJ016049

Sujet: Cyclin J may be involved in cell division and differentiation.

Poids moléculaire: 42 kDa (MW of target protein)