GREM2 anticorps
-
- Antigène Voir toutes GREM2 Anticorps
- GREM2 (Gremlin 2 (GREM2))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GREM2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- GREM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MFWKLSLSLFLVAVLVKVAEARKNRPAGAIPSPYKDGSSNNSERWQHQIK
- Top Product
- Discover our top product GREM2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GREM2 Blocking Peptide, catalog no. 33R-6009, is also available for use as a blocking control in assays to test for specificity of this GREM2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GREM2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GREM2 (Gremlin 2 (GREM2))
- Autre désignation
- GREM2 (GREM2 Produits)
- Synonymes
- anticorps prdc, anticorps zgc:112207, anticorps RGD1560008, anticorps Gremlin2, anticorps Prdc, anticorps CKTSF1B2, anticorps DAND3, anticorps PRDC, anticorps gremlin 2, DAN family BMP antagonist, anticorps gremlin 2, DAN family BMP antagonist b, anticorps gremlin 2, cysteine knot superfamily, anticorps GREM2, anticorps grem2b, anticorps grem2, anticorps Grem2
- Sujet
- This gene encodes a member of the BMP (bone morphogenic protein) antagonist family. Like BMPs, BMP antagonists contain cystine knots and typically form homo- and heterodimers. The CAN (cerberus and dan) subfamily of BMP antagonists, to which this gene belongs, is characterized by a C-terminal cystine knot with an eight-membered ring. The antagonistic effect of the secreted glycosylated protein encoded by this gene is likely due to its direct binding to BMP proteins. As an antagonist of BMP, this gene may play a role in regulating organogenesis, body patterning, and tissue differentiation.
- Poids moléculaire
- 17 kDa (MW of target protein)
-