PPP1R11 anticorps

N° du produit ABIN632318

Détail du produit anti-PPP1R11 anticorps

Antigène: PPP1R11 (Protein Phosphatase 1, Regulatory (Inhibitor) Subunit 11 (PPP1R11))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PPP1R11 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PPP1 R11 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PPP1R11 Blocking Peptide, catalog no. 33R-5629, is also available for use as a blocking control in assays to test for specificity of this PPP1R11 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PPP1R11

Antigène: PPP1R11 (Protein Phosphatase 1, Regulatory (Inhibitor) Subunit 11 (PPP1R11))

Autre désignation: PPP1R11 (PPP1R11 Produits)

Synonymes: anticorps HCG-V, anticorps HCGV, anticorps IPP3, anticorps TCTE5, anticorps TCTEX5, anticorps 1500041B02Rik, anticorps AV117883, anticorps Hcgv, anticorps Tcte5, anticorps Tctex-5, anticorps Tctex5, anticorps wu:fj64e04, anticorps zgc:110245, anticorps protein phosphatase 1 regulatory inhibitor subunit 11, anticorps protein phosphatase 1, regulatory (inhibitor) subunit 11, anticorps PPP1R11, anticorps Ppp1r11, anticorps ppp1r11

Sujet: This gene encodes a specific inhibitor of protein phosphatase-1 (PP1) with a differential sensitivity toward the metal-independent and metal-dependent forms of PP1.

Poids moléculaire: 14 kDa (MW of target protein)