UBLCP1 anticorps (N-Term)

N° du produit ABIN632320

Détail du produit anti-UBLCP1 anticorps

Antigène: UBLCP1 (Ubiquitin-Like Domain Containing CTD Phosphatase 1 (UBLCP1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UBLCP1 est non-conjugé

Application: Western Blotting (WB)

Specificité: UBLCP1 antibody was raised against the N terminal of UBLCP1

Purification: Affinity purified

Immunogène: UBLCP1 antibody was raised using the N terminal of UBLCP1 corresponding to a region with amino acids MALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UBLCP1 Blocking Peptide, catalog no. 33R-5694, is also available for use as a blocking control in assays to test for specificity of this UBLCP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBLCP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UBLCP1

Antigène: UBLCP1 (Ubiquitin-Like Domain Containing CTD Phosphatase 1 (UBLCP1))

Autre désignation: UBLCP1 (UBLCP1 Produits)

Synonymes: anticorps UBLCP1, anticorps DKFZp459P2311, anticorps wu:fb33g09, anticorps zgc:86634, anticorps CPUB1, anticorps 4930527B16Rik, anticorps 8430435I17Rik, anticorps BC002236, anticorps RGD1310386, anticorps ubiquitin like domain containing CTD phosphatase 1, anticorps ubiquitin-like domain containing CTD phosphatase 1, anticorps ubiquitin like domain containing CTD phosphatase 1 S homeolog, anticorps ublcp1, anticorps Ublcp1, anticorps UBLCP1, anticorps ublcp1.S

Sujet: UBLCP1 may specifically dephosphorylate 'Ser-5' of the heptad repeats YSPTSPS in the C-terminal domain of the largest RNA polymerase II subunit.

Poids moléculaire: 37 kDa (MW of target protein)