CCDC78 anticorps (Middle Region)

N° du produit ABIN632324

Détail du produit anti-CCDC78 anticorps

Antigène: CCDC78 (Coiled-Coil Domain Containing 78 (CCDC78))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CCDC78 est non-conjugé

Application: Western Blotting (WB)

Specificité: CCDC78 antibody was raised against the middle region of CCDC78

Purification: Affinity purified

Immunogène: CCDC78 antibody was raised using the middle region of CCDC78 corresponding to a region with amino acids QELRHKAQVPGHSDDHRFQVQPKNTMDPENEQHRLGSGVSVQPPSSGERA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CCDC78 Blocking Peptide, catalog no. 33R-7533, is also available for use as a blocking control in assays to test for specificity of this CCDC78 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC78 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CCDC78

Antigène: CCDC78 (Coiled-Coil Domain Containing 78 (CCDC78))

Autre désignation: CCDC78 (CCDC78 Produits)

Synonymes: anticorps MGC86539, anticorps C16orf25, anticorps CNM4, anticorps JFP10, anticorps Gm938, anticorps Gm950, anticorps coiled-coil domain containing 78 S homeolog, anticorps coiled-coil domain containing 78, anticorps ccdc78.S, anticorps CCDC78, anticorps ccdc78, anticorps Ccdc78

Sujet: The function of CCDC78 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 37 kDa (MW of target protein)

Pathways: Skeletal Muscle Fiber Development