C1ORF74 anticorps (N-Term)

N° du produit ABIN632333

Détail du produit anti-C1ORF74 anticorps

Antigène: C1ORF74 (Chromosome 1 Open Reading Frame 74 (C1ORF74))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C1ORF74 est non-conjugé

Application: Western Blotting (WB)

Specificité: C1 ORF74 antibody was raised against the N terminal Of C1 rf74

Purification: Affinity purified

Immunogène: C1 ORF74 antibody was raised using the N terminal Of C1 rf74 corresponding to a region with amino acids ICLHLAGEVLAVARGLKPAVLYDCNCAGASELQSYLEELKGLGFLTFGLH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C1ORF74 Blocking Peptide, catalog no. 33R-3903, is also available for use as a blocking control in assays to test for specificity of this C1ORF74 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF74 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C1ORF74

Antigène: C1ORF74 (Chromosome 1 Open Reading Frame 74 (C1ORF74))

Autre désignation: C1ORF74 (C1ORF74 Produits)

Synonymes: anticorps C1orf74, anticorps DKFZp469F2128, anticorps chromosome 1 open reading frame 74, anticorps chromosome 1 open reading frame 74 L homeolog, anticorps chromosome 26 C1orf74 homolog, anticorps hypothetical protein LOC100125367, anticorps chromosome 1 open reading frame, human C1orf74, anticorps RIKEN cDNA A130010J15 gene, anticorps chromosome ssa22 open reading frame, human C1orf74, anticorps chromosome 16 open reading frame, human C1orf74, anticorps zgc:112163, anticorps C1orf74, anticorps c1orf74.L, anticorps c1orf74, anticorps C26H1orf74, anticorps LOC100125367, anticorps C1H1orf74, anticorps A130010J15Rik, anticorps cssa22h1orf74, anticorps C16H1orf74, anticorps zgc:112163

Sujet: The specific function of C1orf74 is not yet known.

Poids moléculaire: 29 kDa (MW of target protein)