USP36 anticorps (N-Term)

N° du produit ABIN632340

Détail du produit anti-USP36 anticorps

Antigène: USP36 (Ubiquitin Specific Peptidase 36 (USP36))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp USP36 est non-conjugé

Application: Western Blotting (WB)

Specificité: USP36 antibody was raised against the N terminal of USP36

Purification: Affinity purified

Immunogène: USP36 antibody was raised using the N terminal of USP36 corresponding to a region with amino acids SRHKSGDDPPARRQGSEHTYESCGDGVPAPQKVLFPTERLSLRWERVFRV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

USP36 Blocking Peptide, catalog no. 33R-8754, is also available for use as a blocking control in assays to test for specificity of this USP36 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of USP36 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur USP36

Antigène: USP36 (Ubiquitin Specific Peptidase 36 (USP36))

Autre désignation: USP36 (USP36 Produits)

Synonymes: anticorps wu:fd19b04, anticorps MGC81933, anticorps 2331, anticorps CG5505, anticorps Dmel\\CG5505, anticorps USP36, anticorps Usp36, anticorps anon-WO0118547.247, anticorps dUSP36, anticorps et, anticorps l(3)02331, anticorps mule, anticorps DUB1, anticorps 2700002L06Rik, anticorps mKIAA1453, anticorps ubiquitin specific peptidase 36, anticorps ubiquitin specific peptidase 36 S homeolog, anticorps scrawny, anticorps usp36, anticorps usp36.S, anticorps USP36, anticorps scny, anticorps Usp36

Sujet: Modification of cellular proteins by ubiquitin is an essential regulatory mechanism controlled by the coordinated action of multiple ubiquitin-conjugating and deubiquitinating enzymes such as the one encoded by USP36.

Poids moléculaire: 123 kDa (MW of target protein)