Serotonin Receptor 2B anticorps
-
- Antigène Voir toutes Serotonin Receptor 2B (HTR2B) Anticorps
- Serotonin Receptor 2B (HTR2B)
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Serotonin Receptor 2B est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- Serotonin receptor 2 B antibody was raised using a synthetic peptide corresponding to a region with amino acids QTESIPEEMKQIVEEQGNKLHWAALLILMVIIPTIGGNTLVILAVSLEKK
- Top Product
- Discover our top product HTR2B Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Serotonin receptor 2B Blocking Peptide, catalog no. 33R-7748, is also available for use as a blocking control in assays to test for specificity of this Serotonin receptor 2B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HTR0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Serotonin Receptor 2B (HTR2B)
- Autre désignation
- Serotonin Receptor 2B (HTR2B Produits)
- Synonymes
- anticorps 5-HT2B, anticorps 5HT2B, anticorps 5htr2b, anticorps HTR2B, anticorps 5ht2b, anticorps zgc:194094, anticorps zgc:194119, anticorps AJ012488, anticorps AV377389, anticorps 5-HT(2B), anticorps 5-hydroxytryptamine receptor 2B, anticorps 5-hydroxytryptamine (serotonin) receptor 2B, G protein-coupled, anticorps 5-hydroxytryptamine (serotonin) receptor 2B, anticorps HTR2B, anticorps htr2b, anticorps Htr2b
- Sujet
- Multiple receptor subtypes of serotonin neurotransmitters with multiple physiologic functions have been recognised. The 5-HT-2 receptors mediate many of the central and peripheral physiologic functions of serotonin. Cardiovascular effects include contraction of blood vessels and shape changes in platelets, central nervous system effects include neuronal sensitization to tactile stimuli and mediation of hallucinogenic effects of phenylisopropylamine hallucinogens.
- Poids moléculaire
- 54 kDa (MW of target protein)
- Pathways
- Signalistation JAK/STAT, Inositol Metabolic Process, Regulation of G-Protein Coupled Receptor Protein Signaling, Regulation of Carbohydrate Metabolic Process
-