MED8 anticorps (N-Term)
-
- Antigène Voir toutes MED8 Anticorps
- MED8 (Mediator Complex Subunit 8 (MED8))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MED8 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MED8 antibody was raised against the N terminal of MED8
- Purification
- Affinity purified
- Immunogène
- MED8 antibody was raised using the N terminal of MED8 corresponding to a region with amino acids MQREEKQLEASLDALLSQVADLKNSLGSFICKLENEYGRLTWPSVLDSFA
- Top Product
- Discover our top product MED8 Anticorps primaire
-
anti-Mediator Complex Subunit 8 (MED8) antibody
MED8 Reactivité: Humain, Souris, Rat WB, IF, IHC Hôte: Lapin Polyclonal unconjugated
anti-Mediator Complex Subunit 8 (MED8) (AA 1-59) antibodyMED8 Reactivité: Humain WB, ELISA, IF Hôte: Souris Monoclonal 1D3 unconjugated
anti-Mediator Complex Subunit 8 (MED8) (C-Term) antibodyMED8 Reactivité: Humain, Souris, Rat WB, ELISA, IF, ICC Hôte: Lapin Polyclonal unconjugated
anti-Mediator Complex Subunit 8 (MED8) (AA 1-195) antibodyMED8 Reactivité: Humain, Souris, Rat WB, ELISA, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Mediator Complex Subunit 8 (MED8) (Internal Region) antibodyMED8 Reactivité: Humain WB, ELISA Hôte: Lapin Polyclonal unconjugated
anti-Mediator Complex Subunit 8 (MED8) (Internal Region) antibodyMED8 Reactivité: Humain, Souris, Rat WB, ELISA Hôte: Lapin Polyclonal unconjugated
anti-Mediator Complex Subunit 8 (MED8) (AA 95-122) antibodyMED8 Reactivité: Humain WB Hôte: Lapin Polyclonal RB20608 unconjugated
anti-Mediator Complex Subunit 8 (MED8) (AA 1-59) antibodyMED8 Reactivité: Humain WB, ELISA Hôte: Souris Polyclonal unconjugated
anti-Mediator Complex Subunit 8 (MED8) (AA 1-59) antibodyMED8 Reactivité: Humain WB, ELISA Hôte: Souris Monoclonal 1E5 unconjugated
anti-Mediator Complex Subunit 8 (MED8) (N-Term) antibodyMED8 Reactivité: Humain, Souris, Rat, Boeuf (Vache), Chien, Cobaye, Cheval, Poisson zèbre (Danio rerio), Roussette (Chauve-souris), Hamster, Singe, Porc WB Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MED8 Blocking Peptide, catalog no. 33R-6339, is also available for use as a blocking control in assays to test for specificity of this MED8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MED8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MED8 (Mediator Complex Subunit 8 (MED8))
- Autre désignation
- MED8 (MED8 Produits)
- Synonymes
- anticorps ARC32, anticorps 2210021A15Rik, anticorps AB041805, anticorps MNCb-2386, anticorps zgc:76877, anticorps med8-a, anticorps mediator complex subunit 8, anticorps mediator complex subunit 8 L homeolog, anticorps component of RNA polymerase II, anticorps mediator complex subunit Med8, anticorps MED8, anticorps Med8, anticorps med8, anticorps med8.L
- Sujet
- MED8 is a protein that is one of more than 20 subunits of the mediator complex, first identified in S. cerevisiae, that is required for activation of transcription. MED8 also interacts with elongins B and C, and CUL2 and RBX1, to reconstitute a ubiquitin ligase.
- Poids moléculaire
- 33 kDa (MW of target protein)
- Pathways
- Regulation of Lipid Metabolism by PPARalpha
-
