FBXO16 anticorps (C-Term)

N° du produit ABIN632356

Détail du produit anti-FBXO16 anticorps

Antigène: FBXO16 (F-Box Protein 16 (FBXO16))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FBXO16 est non-conjugé

Application: Western Blotting (WB)

Specificité: FBXO16 antibody was raised against the C terminal of FBXO16

Purification: Affinity purified

Immunogène: FBXO16 antibody was raised using the C terminal of FBXO16 corresponding to a region with amino acids SPLSAFRSSSSLRKKNNSGEKALPPWRSSDKHPTDIIRFNYLDNRDPMET

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FBXO16 Blocking Peptide, catalog no. 33R-8681, is also available for use as a blocking control in assays to test for specificity of this FBXO16 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FBXO16

Antigène: FBXO16 (F-Box Protein 16 (FBXO16))

Autre désignation: FBXO16 (FBXO16 Produits)

Synonymes: anticorps si:ch211-89p3.1, anticorps zgc:112464, anticorps FBX16, anticorps 4932435C24Rik, anticorps Fbx16, anticorps F-box protein 16, anticorps FBXO16, anticorps LOC100150082, anticorps fbxo16, anticorps Fbxo16

Sujet: FBXO16 is a member of the F-box protein family, members of which are characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into three classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXO16 belongs to the Fbx class.

Poids moléculaire: 34 kDa (MW of target protein)