DENND2C anticorps (Middle Region)

N° du produit ABIN632358

Détail du produit anti-DENND2C anticorps

Antigène: DENND2C (DENN/MADD Domain Containing 2C (DENND2C))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DENND2C est non-conjugé

Application: Western Blotting (WB)

Specificité: DENND2 C antibody was raised against the middle region of DENND2

Purification: Affinity purified

Immunogène: DENND2 C antibody was raised using the middle region of DENND2 corresponding to a region with amino acids DIFESKRGKKKVKLHSYTGKELPPTKGETSGNESDAEYLPKNRHKRLAQL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DENND2C Blocking Peptide, catalog no. 33R-1994, is also available for use as a blocking control in assays to test for specificity of this DENND2C antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DENND0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DENND2C

Antigène: DENND2C (DENN/MADD Domain Containing 2C (DENND2C))

Autre désignation: DENND2C (DENND2C Produits)

Synonymes: anticorps si:dkeyp-46c9.6, anticorps MGC145874, anticorps dJ1156J9.1, anticorps A930010I20Rik, anticorps RGD1308197, anticorps DENN domain containing 2C, anticorps DENN/MADD domain containing 2C, anticorps DENND2C, anticorps dennd2c, anticorps Dennd2c

Sujet: The specific function of DENND2C is not yet known.

Poids moléculaire: 100 kDa (MW of target protein)