KCTD21 anticorps (N-Term)
-
- Antigène Tous les produits KCTD21
- KCTD21 (Potassium Channel Tetramerisation Domain Containing 21 (KCTD21))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KCTD21 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- KCTD21 antibody was raised against the N terminal of KCTD21
- Purification
- Affinity purified
- Immunogène
- KCTD21 antibody was raised using the N terminal of KCTD21 corresponding to a region with amino acids RDGKVFRYILNFLRTSHLDLPEDFQEMGLLRREADFYQVQPLIEALQEKE
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KCTD21 Blocking Peptide, catalog no. 33R-7845, is also available for use as a blocking control in assays to test for specificity of this KCTD21 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD21 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KCTD21 (Potassium Channel Tetramerisation Domain Containing 21 (KCTD21))
- Autre désignation
- KCTD21 (KCTD21 Produits)
- Synonymes
- anticorps EG622320, anticorps KCASH2, anticorps RGD1559529, anticorps potassium channel tetramerization domain containing 21, anticorps potassium channel tetramerisation domain containing 21, anticorps KCTD21, anticorps Kctd21
- Sujet
- KCTD21 contains 1 BTB (POZ) domain. The exact function of KCTD21 remains unknown.
- Poids moléculaire
- 30 kDa (MW of target protein)
-