MPEG1 anticorps (C-Term)

N° du produit ABIN632360

Détail du produit anti-MPEG1 anticorps

Antigène: MPEG1 (Macrophage Expressed Gene 1 (MPEG1))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MPEG1 est non-conjugé

Application: Western Blotting (WB)

Specificité: MPEG1 antibody was raised against MPEG1

Purification: Affinity purified

Immunogène: MPEG1 antibody was raised using a region of MPEG1 corresponding to amino acids: TILAVVITLAIYGTRKFKKKAYQAIEERQSLVPGTAATGDTTYQEQGQSP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MPEG1 Blocking Peptide, is also available for use as a blocking control in assays to test for specificity of this MPEG1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPEG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MPEG1

Antigène: MPEG1 (Macrophage Expressed Gene 1 (MPEG1))

Autre désignation: MPEG1 (MPEG1 Produits)

Synonymes: anticorps MPEG1, anticorps DKFZp469A1716, anticorps MPG1, anticorps MPS1, anticorps Mpg-1, anticorps fj09e08, anticorps wu:fb14d06, anticorps wu:fj09e08, anticorps zgc:66409, anticorps macrophage expressed 1, anticorps macrophage expressed 1, tandem duplicate 1, anticorps macrophage expressed gene 1, anticorps MPEG1, anticorps Mpeg1, anticorps mpeg1.1

Sujet: The function of MPEG1 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 78 kDa (MW of target protein)