SENP5 anticorps (Middle Region)

N° du produit ABIN632368

Détail du produit anti-SENP5 anticorps

Antigène: SENP5 (SUMO1/sentrin Specific Peptidase 5 (SENP5))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SENP5 est non-conjugé

Application: Western Blotting (WB)

Specificité: SENP5 antibody was raised against the middle region of SENP5

Purification: Affinity purified

Immunogène: SENP5 antibody was raised using the middle region of SENP5 corresponding to a region with amino acids LSGFLDEVMKKYGSLVPLSEKEVLGRLKDVFNEDFSNRKPFINREITNYR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SENP5 Blocking Peptide, catalog no. 33R-5426, is also available for use as a blocking control in assays to test for specificity of this SENP5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SENP5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SENP5

Antigène: SENP5 (SUMO1/sentrin Specific Peptidase 5 (SENP5))

Autre désignation: SENP5 (SENP5 Produits)

Synonymes: anticorps 6230429P13Rik, anticorps A730063F07Rik, anticorps AI851888, anticorps BB189556, anticorps SMT3IP3, anticorps SENP5, anticorps Senp5, anticorps senp5, anticorps SUMO1/sentrin specific peptidase 5, anticorps SUMO/sentrin specific peptidase 5, anticorps SUMO1/sentrin specific peptidase 5 L homeolog, anticorps SENP5, anticorps Senp5, anticorps senp5, anticorps senp5.L

Sujet: The reversible posttranslational modification of proteins by the addition of small ubiquitin-like SUMO proteins is required for numerous biologic processes. SUMO-specific proteases, such as SENP5, are responsible for the initial processing of SUMO precursors to generate a C-terminal diglycine motif required for the conjugation reaction. They also have isopeptidase activity for the removal of SUMO from high molecular mass SUMO conjugates.

Poids moléculaire: 87 kDa (MW of target protein)